PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART07G07450.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 454aa    MW: 49169.9 Da    PI: 5.7465
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART07G07450.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.2e-16108154148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEde l + v+ +G + W+ Ia+ ++ gR +kqc++rw ++l
  OBART07G07450.1 108 KGGWTREEDEVLRQMVRHHGDRKWAEIAKSLP-GRVGKQCRERWTNHL 154
                      688*****************************.************996 PP

2Myb_DNA-binding52.79.6e-17162202345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       WT+eEd  l++a++ +G+  W++Ia++++ gR+++ +k++w+
  OBART07G07450.1 162 IWTEEEDRMLIEAHQTYGNS-WSAIAKRLP-GRSENTIKNHWN 202
                      6*****************99.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.56103158IPR017930Myb domain
SuperFamilySSF466895.19E-31105201IPR009057Homeodomain-like
SMARTSM007173.2E-15107156IPR001005SANT/Myb domain
PfamPF002494.0E-15108154IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-26110161IPR009057Homeodomain-like
CDDcd001672.02E-15111154No hitNo description
SMARTSM007174.8E-17159207IPR001005SANT/Myb domain
PROSITE profilePS5129417.517159209IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-22162206IPR009057Homeodomain-like
PfamPF002499.7E-16163202IPR001005SANT/Myb domain
CDDcd001672.89E-14163205No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 454 aa     Download sequence    Send to blast
MAAASNSFLN QELVKVADGV SDWHLPSSSH GGTCHTNTRG APITVGVPDL GCPVSSIGMA  60
TSSSLMPKEG LTTASYNSVV AFPVGATMVP QQQQTQAAGS NDNPGLVKGG WTREEDEVLR  120
QMVRHHGDRK WAEIAKSLPG RVGKQCRERW TNHLHPDIKK DIWTEEEDRM LIEAHQTYGN  180
SWSAIAKRLP GRSENTIKNH WNATKRSLNS KREQTVPGQP SLLENYIRSC QHMLPSETVP  240
PPPAPPAPFD ISRYGNSGVI GASPTLPVVQ EPGTSTPPGL VMFLDLLNQA IPHPPQPETM  300
DLFNMTPEVS HLNTSGYCLQ LDAGGNLYYG RLPAPAPVQP HGISTQDLQD TPHLSLYYPL  360
LSFAGSHTDG TVEFDHQLSN PDGGHYGEEA GLSSVTAGGS ANGMDDNDVV QMASNQFMMP  420
SEDEGNSFLN QELLMVVSNM TDRHIMRSHG GASY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-431042103110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126150.0CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645903.10.0PREDICTED: transcription factor RAX1-like
TrEMBLA0A0D3GNQ50.0A0A0D3GNQ5_9ORYZ; Uncharacterized protein
STRINGORGLA07G0062800.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.13e-52myb domain protein 98